PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03155.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 345aa    MW: 37900 Da    PI: 9.4951
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03155.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.24.3e-3972130361
                   zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                              e+alkcprCdstntkfCy+nny+l+qPr+fCk+CrryWt+GGalrnvPvGgg r+nk+s
  Rsa1.0_03155.1_g00006.1  72 EAALKCPRCDSTNTKFCYFNNYNLTQPRHFCKTCRRYWTRGGALRNVPVGGGFRRNKRS 130
                              6789*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-3855129IPR003851Zinc finger, Dof-type
PfamPF027012.0E-3274129IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.46975129IPR003851Zinc finger, Dof-type
PROSITE patternPS01361077113IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MVFSSLPVNQ FDSHNWQQQG NTQQLDRVTS DQNPSYNLPQ FSSPPASQAG SSQARVNSMV  60
ERARIAKIPL PEAALKCPRC DSTNTKFCYF NNYNLTQPRH FCKTCRRYWT RGGALRNVPV  120
GGGFRRNKRS KLNGGRSKAT VVVPADNNNT TSLLPCQPSY SNPSKFLSYG QMPGFNSNLP  180
ILPPFQSLGD YNPSGIGLDW SSSGGILDPW RISLLQQPQQ FPFLINTKGL EQSSNVMYPS  240
LEGNGGVNHA KLQQESSDYS NQLKSKPLMD MASSGDQAVQ ARFVKAEEND QGGNGVSNLS  300
RNFLGNMNIK PVEENDGYTS WGGSSNISSS WTGFTSNNST GHLSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124131RRNKRSKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013708600.10.0PREDICTED: dof zinc finger protein DOF3.6-like isoform X1
RefseqXP_013708601.10.0PREDICTED: dof zinc finger protein DOF3.6-like isoform X2
SwissprotQ9M2U11e-153DOF36_ARATH; Dof zinc finger protein DOF3.6
TrEMBLM4CSG40.0M4CSG4_BRARP; Uncharacterized protein
STRINGBra007156.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17132886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.21e-145OBF-binding protein 3